| Protein or peptide name: | miPEP164a |
| Chromosome: | 2 |
| Protein or peptide start site: | 19520555 |
| Protein or peptide end site: | 19520665 |
| ncRNA start site: | 19520517 |
| ncRNA end site: | 19521033 |
| Genome Browser: | NA |
| Protein or peptide sequence: | MPSWHGMVLLPYVKHTHASTHTHTHNIYGCACELVFH |
| Protein or peptide length: | 37aa |
| ncRNA type: | pri-miRNA |
| ncRNA name: | pri-miR164a |
| Entrez ID: | NA |
| Experimental species: | Arabidopsis thaliana |
| Experimental techniques: | Fluorescence microscopy/Western blotting/Immunoblots |
| Experimental sample (cell line and/or tissue): | Arabidopsis thaliana |
| Description: | Five other pri-miRNAs of A. thaliana and M. truncatula encode active miPEPs, suggesting that miPEPs are widespread throughout the plant kingdom. |
| Subcellular location: | NA |
| Function: | Synthetic miPEP171b and miPEP165a peptides applied to plants specifically trigger the accumulation of miR171b and miR165a, leading to reduction of lateral root development and stimulation of main root growth, respectively, suggesting that miPEPs might have agronomical applications. |
| Title of paper: | Primary transcripts of microRNAs encode regulatory peptides |
| PMID: | 25807486 |
| Year of publication: | 2015 |
